Lineage for d1hnxm_ (1hnx M:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1765Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 1802Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 1803Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 1804Protein Ribosomal protein S13 [46948] (1 species)
  7. 1805Species Thermus thermophilus [TaxId:274] [46949] (6 PDB entries)
  8. 1811Domain d1hnxm_: 1hnx M: [16297]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxm_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxm_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1hnxm_:

Click to download the PDB-style file with coordinates for d1hnxm_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxm_: