Lineage for d1hnwm_ (1hnw M:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1765Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 1802Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 1803Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 1804Protein Ribosomal protein S13 [46948] (1 species)
  7. 1805Species Thermus thermophilus [TaxId:274] [46949] (6 PDB entries)
  8. 1810Domain d1hnwm_: 1hnw M: [16296]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwm_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwm_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1hnwm_:

Click to download the PDB-style file with coordinates for d1hnwm_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwm_: