SCOPe 2.01: Domain d2b05a_: 2b05 A:

Lineage for d2b05a_ (2b05 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (22 PDB entries)

8. Domain d2b05a_: 2b05 A: [162955]
   automated match to d1qjaa_

Details for d2b05a_

PDB Entry: 2b05, 2.55 Å

PDB Description: Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide

PDB Compounds: (A:) 14-3-3 protein gamma

SCOPe Domain Sequences for d2b05a_:

Sequence; same for both SEQRES and ATOM records:

>d2b05a_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt

Timeline for d2b05a_:

• d2b05a_ is new in SCOPe 2.01-stable
  
• d2b05a_ appears in SCOPe 2.02
  
• d2b05a_ appears in the current release, SCOPe 2.08