Lineage for d2au1a_ (2au1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927442Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 proteins)
    automatically mapped to Pfam PF09028
  6. 2927443Protein IgG-specific endopeptidase IdeS (Sib38) [117763] (1 species)
  7. 2927444Species Streptococcus pyogenes [TaxId:1314] [117764] (2 PDB entries)
    Uniprot Q9F1R7 38-339 # SPy0861
  8. 2927446Domain d2au1a_: 2au1 A: [162897]
    automated match to d1y08a_
    complexed with bme

Details for d2au1a_

PDB Entry: 2au1 (more details), 2.4 Å

PDB Description: Crystal Structure of group A Streptococcus MAC-1 orthorhombic form
PDB Compounds: (A:) IgG-degrading protease

SCOPe Domain Sequences for d2au1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2au1a_ d.3.1.12 (A:) IgG-specific endopeptidase IdeS (Sib38) {Streptococcus pyogenes [TaxId: 1314]}
vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllcgaatagnmlhwwf
dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk
hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf
keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds
nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn

SCOPe Domain Coordinates for d2au1a_:

Click to download the PDB-style file with coordinates for d2au1a_.
(The format of our PDB-style files is described here.)

Timeline for d2au1a_: