Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 proteins) automatically mapped to Pfam PF09028 |
Protein IgG-specific endopeptidase IdeS (Sib38) [117763] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [117764] (2 PDB entries) Uniprot Q9F1R7 38-339 # SPy0861 |
Domain d2au1a_: 2au1 A: [162897] automated match to d1y08a_ complexed with bme |
PDB Entry: 2au1 (more details), 2.4 Å
SCOPe Domain Sequences for d2au1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2au1a_ d.3.1.12 (A:) IgG-specific endopeptidase IdeS (Sib38) {Streptococcus pyogenes [TaxId: 1314]} vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllcgaatagnmlhwwf dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn
Timeline for d2au1a_: