Lineage for d1dv0a_ (1dv0 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45908Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 45929Superfamily a.5.2: UBA-like [46934] (2 families) (S)
  5. 45930Family a.5.2.1: UBA domain [46935] (1 protein)
  6. 45931Protein C-terminal UBA domain of the hhr23a DNA repair protein [46936] (1 species)
  7. 45932Species Human (Homo sapiens) [TaxId:9606] [46937] (2 PDB entries)
  8. 45934Domain d1dv0a_: 1dv0 A: [16289]

Details for d1dv0a_

PDB Entry: 1dv0 (more details)

PDB Description: Refined NMR solution structure of the C-terminal UBA domain of the human homologue of RAD23A (HHR23A)
PDB Compounds: (A:)

SCOP Domain Sequences for d1dv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv0a_ a.5.2.1 (A:) C-terminal UBA domain of the hhr23a DNA repair protein {Human (Homo sapiens)}
qekeaierlkalgfpeslviqayfaceknenlaanfllsqnfdde

SCOP Domain Coordinates for d1dv0a_:

Click to download the PDB-style file with coordinates for d1dv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1dv0a_: