SCOPe 2.02: Domain d2aqsa_: 2aqs A:

Lineage for d2aqsa_ (2aqs A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Neisseria meningitidis [TaxId:487] [187416] (6 PDB entries)

8. Domain d2aqsa_: 2aqs A: [162871]
   automated match to d2apsa_
   complexed with cu, cu1, zn; mutant

Details for d2aqsa_

PDB Entry: 2aqs, 1.7 Å

PDB Description: cu/zn superoxide dismutase from neisseria meningitidis k91e, k94e double mutant

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2aqsa_:

Sequence; same for both SEQRES and ATOM records:

>d2aqsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Neisseria meningitidis [TaxId: 487]}
tipkgasievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpsc
epkeeegeltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprl
khlddvrghsimihtggdnhsdhpaplggggprmacgvik

Timeline for d2aqsa_:

• d2aqsa_ first appeared in SCOPe 2.01
  
• d2aqsa_ appears in SCOPe 2.03
  
• d2aqsa_ appears in the current release, SCOPe 2.08