Lineage for d2aqnc_ (2aqn C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 937083Species Neisseria meningitidis [TaxId:487] [187416] (6 PDB entries)
  8. 937088Domain d2aqnc_: 2aqn C: [162862]
    automated match to d2apsa_
    complexed with cu, cu1, so4, zn

Details for d2aqnc_

PDB Entry: 2aqn (more details), 1.4 Å

PDB Description: CU/ZN superoxide dismutase from neisseria meningitidis
PDB Compounds: (C:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2aqnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqnc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Neisseria meningitidis [TaxId: 487]}
asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkek
egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
vrghsimihtggdnhsdhpaplggggprmacgvik

SCOPe Domain Coordinates for d2aqnc_:

Click to download the PDB-style file with coordinates for d2aqnc_.
(The format of our PDB-style files is described here.)

Timeline for d2aqnc_: