Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Neisseria meningitidis [TaxId:487] [187416] (6 PDB entries) |
Domain d2aqnb_: 2aqn B: [162861] automated match to d2apsa_ complexed with cu, cu1, so4, zn |
PDB Entry: 2aqn (more details), 1.4 Å
SCOPe Domain Sequences for d2aqnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aqnb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Neisseria meningitidis [TaxId: 487]} asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkek egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd vrghsimihtggdnhsdhpaplggggprmacgvik
Timeline for d2aqnb_: