SCOPe 2.05: Domain d2apfa_: 2apf A:

Lineage for d2apfa_ (2apf A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (7 PDB entries)

8. Domain d2apfa_: 2apf A: [162850]
   automated match to d2aq2a1
   complexed with mla

Details for d2apfa_

PDB Entry: 2apf, 1.8 Å

PDB Description: crystal structure of the a52v/s54n/k66e variant of the murine t cell receptor v beta 8.2 domain

PDB Compounds: (A:) T cell receptor beta chain V

SCOPe Domain Sequences for d2apfa_:

Sequence; same for both SEQRES and ATOM records:

>d2apfa_ b.1.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ileaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
dipdgyeasrpsqeqfslilelatpsqttvyfcasggggtlyfgagtrlsvl

Timeline for d2apfa_:

• d2apfa_ first appeared in SCOPe 2.01
  
• d2apfa_ appears in SCOPe 2.04
  
• d2apfa_ appears in SCOPe 2.06
  
• d2apfa_ appears in the current release, SCOPe 2.08