Lineage for d2apba_ (2apb A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290539Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (7 PDB entries)
  8. 1290540Domain d2apba_: 2apb A: [162849]
    automated match to d2aq2a1
    complexed with mla

Details for d2apba_

PDB Entry: 2apb (more details), 1.8 Å

PDB Description: crystal structure of the s54n variant of murine t cell receptor vbeta 8.2 domain
PDB Compounds: (A:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2apba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2apba_ b.1.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagntekgdi
pdgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

SCOPe Domain Coordinates for d2apba_:

Click to download the PDB-style file with coordinates for d2apba_.
(The format of our PDB-style files is described here.)

Timeline for d2apba_: