Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Agkistrodon contortrix [TaxId:8713] [187405] (2 PDB entries) |
Domain d2aipa_: 2aip A: [162819] automated match to d1op2a_ complexed with act, gol, nag, so4 |
PDB Entry: 2aip (more details), 1.65 Å
SCOPe Domain Sequences for d2aipa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aipa_ b.47.1.2 (A:) automated matches {Agkistrodon contortrix [TaxId: 8713]} viggdecninehrflalvyangslcggtlinqewvltarhcdrgnmriylgmhnlkvlnk dalrrfpkekyfclntrndtiwdkdimlirlnrpvrnsahiaplslpsnppsvgsvcrim gwgtitspnatlpdvphcaninildyavcqaaykglaattlcagileggkdtckgdsggp licngqfqgilsvggnpcaqprkpgiytkvfdytdwiqsiisgntdatcpp
Timeline for d2aipa_: