![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
![]() | Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins) automatically mapped to Pfam PF01923 |
![]() | Protein automated matches [190476] (1 species) not a true protein |
![]() | Species Bacillus halodurans [TaxId:272558] [187401] (1 PDB entry) |
![]() | Domain d2ah6c_: 2ah6 C: [162801] automated match to d1rtyb_ complexed with edo, no3 |
PDB Entry: 2ah6 (more details), 1.6 Å
SCOPe Domain Sequences for d2ah6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ah6c_ a.25.2.2 (C:) automated matches {Bacillus halodurans [TaxId: 272558]} ddtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlkvkedr pykakqeivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqq egeinpivlkylnrlsdyffavarvvnsrlqvpdveyersai
Timeline for d2ah6c_: