Lineage for d2ah6b_ (2ah6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1992598Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 1992603Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins)
    automatically mapped to Pfam PF01923
  6. 1992612Protein automated matches [190476] (1 species)
    not a true protein
  7. 1992613Species Bacillus halodurans [TaxId:272558] [187401] (1 PDB entry)
  8. 1992615Domain d2ah6b_: 2ah6 B: [162800]
    automated match to d1rtyb_
    complexed with edo, no3

Details for d2ah6b_

PDB Entry: 2ah6 (more details), 1.6 Å

PDB Description: Crystal structure of a putative cobalamin adenosyltransferase (bh1595) from bacillus halodurans c-125 at 1.60 A resolution
PDB Compounds: (B:) BH1595, unknown conserved protein

SCOPe Domain Sequences for d2ah6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ah6b_ a.25.2.2 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
rlakddtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlkv
kedrpykakqeivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvv
rlqqegeinpivlkylnrlsdyffavarvvnsrlqvpdveye

SCOPe Domain Coordinates for d2ah6b_:

Click to download the PDB-style file with coordinates for d2ah6b_.
(The format of our PDB-style files is described here.)

Timeline for d2ah6b_: