SCOPe 2.03: Domain d2ah6a_: 2ah6 A:

Lineage for d2ah6a_ (2ah6 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins)
   automatically mapped to Pfam PF01923

6. Protein automated matches [190476] (1 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [187401] (1 PDB entry)

8. Domain d2ah6a_: 2ah6 A: [162799]
   automated match to d1rtyb_
   complexed with edo, no3

Details for d2ah6a_

PDB Entry: 2ah6, 1.6 Å

PDB Description: Crystal structure of a putative cobalamin adenosyltransferase (bh1595) from bacillus halodurans c-125 at 1.60 A resolution

PDB Compounds: (A:) BH1595, unknown conserved protein

SCOPe Domain Sequences for d2ah6a_:

Sequence, based on SEQRES records:

>d2ah6a_ a.25.2.2 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
dtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlkvkedrp
ykakqeivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqqe
geinpivlkylnrlsdyffavarvvnsrlqvpdveye

Sequence, based on observed residues (ATOM records):

>d2ah6a_ a.25.2.2 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
dtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlpykakqe
ivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqqegeinpi
vlkylnrlsdyffavarvvnsrlqvpdveye

Timeline for d2ah6a_:

• d2ah6a_ first appeared in SCOPe 2.01
  
• d2ah6a_ appears in SCOPe 2.02
  
• d2ah6a_ appears in SCOPe 2.04
  
• d2ah6a_ appears in the current release, SCOPe 2.08