Lineage for d2aenf_ (2aen F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1309020Species Rotavirus a [TaxId:10941] [187397] (1 PDB entry)
  8. 1309026Domain d2aenf_: 2aen F: [162770]
    automated match to d1kqra_
    complexed with eoh, gol

Details for d2aenf_

PDB Entry: 2aen (more details), 1.6 Å

PDB Description: crystal structure of the rotavirus strain ds-1 vp8* core
PDB Compounds: (F:) Outer capsid protein VP4, VP8* core

SCOPe Domain Sequences for d2aenf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aenf_ b.29.1.0 (F:) automated matches {Rotavirus a [TaxId: 10941]}
tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d2aenf_:

Click to download the PDB-style file with coordinates for d2aenf_.
(The format of our PDB-style files is described here.)

Timeline for d2aenf_: