Lineage for d1bdxa1 (1bdx A:156-203)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763590Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
    possibly related to UBA-like domains
  5. 763591Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 763592Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
    tetramer; binds Holliday junction
  7. 763593Species Escherichia coli [TaxId:562] [46932] (4 PDB entries)
  8. 763597Domain d1bdxa1: 1bdx A:156-203 [16276]
    Other proteins in same PDB: d1bdxa2, d1bdxa3, d1bdxb2, d1bdxb3, d1bdxc2, d1bdxc3, d1bdxd2, d1bdxd3

Details for d1bdxa1

PDB Entry: 1bdx (more details), 6 Å

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only
PDB Compounds: (A:) holliday junction DNA helicase ruva

SCOP Domain Sequences for d1bdxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxa1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]}
tddaeqeavaalvalgykpqeasrmvskiarpdassetlirealraal

SCOP Domain Coordinates for d1bdxa1:

Click to download the PDB-style file with coordinates for d1bdxa1.
(The format of our PDB-style files is described here.)

Timeline for d1bdxa1: