SCOPe 2.04: Domain d2a72b_: 2a72 B:

Lineage for d2a72b_ (2a72 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)

8. Domain d2a72b_: 2a72 B: [162701]
   automated match to d1fqia_
   complexed with cl

Details for d2a72b_

PDB Entry: 2a72, 2 Å

PDB Description: structure of the regulator of g-protein signaling domain of rgs7

PDB Compounds: (B:) Regulator of G-protein signalling 7

SCOPe Domain Sequences for d2a72b_:

Sequence; same for both SEQRES and ATOM records:

>d2a72b_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smkepsqqrvkrwgfgmdealkdpvgreqflkflesefssenlrfwlavedlkkrpikev
psrvqeiwqeflapgapsainldsksydktthnvkepgrytfedaqehiyklmksdsypr
firssayqellqa

Timeline for d2a72b_:

• d2a72b_ first appeared in SCOPe 2.01
  
• d2a72b_ appears in SCOPe 2.03
  
• d2a72b_ appears in SCOPe 2.05
  
• d2a72b_ appears in the current release, SCOPe 2.08, called d2a72b1