Lineage for d2a46a_ (2a46 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940671Species Anemonia majano [TaxId:105399] [188526] (3 PDB entries)
  8. 2940672Domain d2a46a_: 2a46 A: [162669]
    automated match to d1mova_
    complexed with bme

Details for d2a46a_

PDB Entry: 2a46 (more details), 1.65 Å

PDB Description: crystal structures of amfp486, a cyan fluorescent protein from anemonia majano, and variants
PDB Compounds: (A:) GFP-like fluorescent chromoprotein amFP486

SCOPe Domain Sequences for d2a46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a46a_ d.22.1.0 (A:) automated matches {Anemonia majano [TaxId: 105399]}
nkfigddmkmtyhmdgcvnghyftvkgegngkpyegtqtstfkvtmanggplafsfdils
tvfkygnrcftayptsmpdyfkqafpdgmsyertftyedggvatasweislkgncfehks
tfhgvnfpadgpvmakkttgwdpsfekmtvcdgilkgdvtaflmlqgggnyrcqfhtsyk
tkkpvtmppnhvvehriartdldkggnsvqltehavahit

SCOPe Domain Coordinates for d2a46a_:

Click to download the PDB-style file with coordinates for d2a46a_.
(The format of our PDB-style files is described here.)

Timeline for d2a46a_: