Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen gamma chain [88898] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries) Uniprot P02679 |
Domain d2a45i_: 2a45 I: [162665] Other proteins in same PDB: d2a45.1, d2a45.2, d2a45g_, d2a45h_, d2a45j_, d2a45k_ central region only complexed with 0g6, po4 |
PDB Entry: 2a45 (more details), 3.65 Å
SCOPe Domain Sequences for d2a45i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a45i_ h.1.8.1 (I:) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]} dnccilderfgsycpttcgiadflstyqtkvdkdlqsled
Timeline for d2a45i_: