SCOPe 2.01: Domain d1zzya_: 1zzy A:

Lineage for d1zzya_ (1zzy A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (14 species)

7. Species Escherichia coli [TaxId:562] [52836] (44 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d1zzya_: 1zzy A: [162639]
   automated match to d1xoaa_
   mutant

Details for d1zzya_

PDB Entry: 1zzy, 2.5 Å

PDB Description: crystal structure of thioredoxin mutant l7v

PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d1zzya_:

Sequence; same for both SEQRES and ATOM records:

>d1zzya_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihvtddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d1zzya_:

• d1zzya_ is new in SCOPe 2.01-stable
  
• d1zzya_ appears in SCOPe 2.02
  
• d1zzya_ appears in the current release, SCOPe 2.08