SCOPe 2.08: Domain d1zwse_: 1zws E:

Lineage for d1zwse_ (1zws E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d1zwse_: 1zws E: [162618]
   automated match to d1ig1a_

Details for d1zwse_

PDB Entry: 1zws, 2.9 Å

PDB Description: crystal structure of the catalytic domain of human drp-1 kinase

PDB Compounds: (E:) DAP-kinase related protein 1

SCOPe Domain Sequences for d1zwse_:

Sequence; same for both SEQRES and ATOM records:

>d1zwse_ d.144.1.7 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
shtselakdfirkllvketrkrltiqealrhpwitpvd

Timeline for d1zwse_:

• d1zwse_ first appeared in SCOPe 2.01
  
• d1zwse_ appears in SCOPe 2.07