Lineage for d1e3pa1 (1e3p A:263-345)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308993Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family) (S)
  5. 2308994Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein)
  6. 2308995Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (2 species)
    links two duplicated two-domain units formed by domains 1-2 and 4-5
  7. 2308998Species Streptomyces antibioticus [TaxId:1890] [46918] (2 PDB entries)
  8. 2308999Domain d1e3pa1: 1e3p A:263-345 [16258]
    Other proteins in same PDB: d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7
    complexed with so4, wo4

Details for d1e3pa1

PDB Entry: 1e3p (more details), 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOPe Domain Sequences for d1e3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3pa1 a.4.9.1 (A:263-345) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus [TaxId: 1890]}
yqddvlealsaavrpelsaaltiagkqdreaeldrvkalaaekllpefegrekeisaayr
altkslvrerviaekkridgrgv

SCOPe Domain Coordinates for d1e3pa1:

Click to download the PDB-style file with coordinates for d1e3pa1.
(The format of our PDB-style files is described here.)

Timeline for d1e3pa1: