SCOP 1.75: Domain d1e3pa1: 1e3p A:263-345

Lineage for d1e3pa1 (1e3p A:263-345)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family)

5. Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein)

6. Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (2 species)
   links two duplicated two-domain units formed by domains 1-2 and 4-5

7. Species Streptomyces antibioticus [TaxId:1890] [46918] (2 PDB entries)

8. Domain d1e3pa1: 1e3p A:263-345 [16258]
   Other proteins in same PDB: d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7
   complexed with so4, wo4

Details for d1e3pa1

PDB Entry: 1e3p, 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme

PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOP Domain Sequences for d1e3pa1:

Sequence; same for both SEQRES and ATOM records:

>d1e3pa1 a.4.9.1 (A:263-345) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus [TaxId: 1890]}
yqddvlealsaavrpelsaaltiagkqdreaeldrvkalaaekllpefegrekeisaayr
altkslvrerviaekkridgrgv

Timeline for d1e3pa1:

• d1e3pa1 first appeared (with stable ids) in SCOP 1.55
  
• d1e3pa1 appears in SCOP 1.73
  
• d1e3pa1 appears in SCOPe 2.01
  
• d1e3pa1 appears in the current release, SCOPe 2.08