Lineage for d1e3pa1 (1e3p A:263-345)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1736Superfamily a.4.9: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 3 [46915] (1 family) (S)
  5. 1737Family a.4.9.1: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 3 [46916] (1 protein)
  6. 1738Protein Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 3 [46917] (1 species)
  7. 1739Species Streptomyces antibioticus [TaxId:1890] [46918] (2 PDB entries)
  8. 1741Domain d1e3pa1: 1e3p A:263-345 [16258]
    Other proteins in same PDB: d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7

Details for d1e3pa1

PDB Entry: 1e3p (more details), 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3pa1 a.4.9.1 (A:263-345) Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus}
yqddvlealsaavrpelsaaltiagkqdreaeldrvkalaaekllpefegrekeisaayr
altkslvrerviaekkridgrgv

SCOP Domain Coordinates for d1e3pa1:

Click to download the PDB-style file with coordinates for d1e3pa1.
(The format of our PDB-style files is described here.)

Timeline for d1e3pa1: