Lineage for d1zsla_ (1zsl A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1318750Protein Coagulation factor XI [117237] (1 species)
  7. 1318751Species Human (Homo sapiens) [TaxId:9606] [117238] (26 PDB entries)
    Uniprot P03951 388-624
  8. 1318764Domain d1zsla_: 1zsl A: [162578]
    automated match to d1xx9b_
    complexed with 624

Details for d1zsla_

PDB Entry: 1zsl (more details), 2.05 Å

PDB Description: factor xi complexed with a pyrimidinone inhibitor
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d1zsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zsla_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseiaedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d1zsla_:

Click to download the PDB-style file with coordinates for d1zsla_.
(The format of our PDB-style files is described here.)

Timeline for d1zsla_: