SCOP 1.73: Domain d1hnxr_: 1hnx R:

Lineage for d1hnxr_ (1hnx R:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries)

8. Domain d1hnxr_: 1hnx R: [16256]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxs_, d1hnxt_, d1hnxv_
   complexed with mg, pcy, zn

Details for d1hnxr_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d1hnxr_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1hnxr_:

• d1hnxr_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxr_ appears in SCOP 1.71
  
• d1hnxr_ appears in SCOP 1.75
  
• d1hnxr_ appears in the current release, SCOPe 2.08