![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries) |
![]() | Domain d1hnxr_: 1hnx R: [16256] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxs_, d1hnxt_, d1hnxv_ complexed with mg, pcy, zn |
PDB Entry: 1hnx (more details), 3.4 Å
SCOP Domain Sequences for d1hnxr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d1hnxr_: