SCOPe 2.03: Domain d1zmof_: 1zmo F:

Lineage for d1zmof_ (1zmo F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Arthrobacter sp. [TaxId:168809] [188194] (1 PDB entry)

8. Domain d1zmof_: 1zmo F: [162547]
   automated match to d1pwxa_

Details for d1zmof_

PDB Entry: 1zmo, 2 Å

PDB Description: Apo structure of haloalcohol dehalogenase HheA of Arthrobacter sp. AD2

PDB Compounds: (F:) halohydrin dehalogenase

SCOPe Domain Sequences for d1zmof_:

Sequence; same for both SEQRES and ATOM records:

>d1zmof_ c.2.1.0 (F:) automated matches {Arthrobacter sp. [TaxId: 168809]}
vialvtharhfagpaavealtqdgytvvchdasfadaaerqrfesenpgtialaeqkper
lvdatlqhgeaidtivsndyiprpmnrlplegtseadirqmfealsifpilllqsaiapl
raaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnffn
nptyfptsdwennpelrervdrdvplgrlgrpdemgalitflasrraapivgqffaftgg
ylp

Timeline for d1zmof_:

• d1zmof_ first appeared in SCOPe 2.01
  
• d1zmof_ appears in SCOPe 2.02
  
• d1zmof_ appears in SCOPe 2.04
  
• d1zmof_ appears in the current release, SCOPe 2.08