SCOPe 2.02: Domain d1hnzr_: 1hnz R:

Lineage for d1hnzr_ (1hnz R:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d1hnzr_: 1hnz R: [16254]
   Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzs_, d1hnzt_, d1hnzv_
   complexed with hyg, mg, zn

Details for d1hnzr_

PDB Entry: 1hnz, 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1hnzr_:

Sequence; same for both SEQRES and ATOM records:

>d1hnzr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1hnzr_:

• d1hnzr_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnzr_ appears in SCOPe 2.01
  
• d1hnzr_ appears in SCOPe 2.03
  
• d1hnzr_ appears in the current release, SCOPe 2.08