Lineage for d1hr0r_ (1hr0 R:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 278372Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 278373Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 278374Protein Ribosomal protein S18 [46913] (1 species)
  7. 278375Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries)
  8. 278378Domain d1hr0r_: 1hr0 R: [16253]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0r_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1hr0r_:

Click to download the PDB-style file with coordinates for d1hr0r_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0r_: