SCOP 1.61: Domain d1mmsa1: 1mms A:71-140

Lineage for d1mmsa1 (1mms A:71-140)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [46910] (1 PDB entry)

8. Domain d1mmsa1: 1mms A:71-140 [16247]
   Other proteins in same PDB: d1mmsa2

Details for d1mmsa1

PDB Entry: 1mms, 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex

SCOP Domain Sequences for d1mmsa1:

Sequence; same for both SEQRES and ATOM records:

>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

Timeline for d1mmsa1:

• d1mmsa1 first appeared (with stable ids) in SCOP 1.55
  
• d1mmsa1 appears in SCOP 1.59
  
• d1mmsa1 appears in SCOP 1.63
  
• d1mmsa1 appears in the current release, SCOPe 2.08