Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries) |
Domain d1zgqa_: 1zgq A: [162464] automated match to d1g7ka_ complexed with peg |
PDB Entry: 1zgq (more details), 1.9 Å
SCOPe Domain Sequences for d1zgqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zgqa_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]} nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf mygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfi gvnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakk pvqlpgyyyvdsklditshnedytiveqyertegrhhlfl
Timeline for d1zgqa_: