Lineage for d1foy__ (1foy -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) 
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) Protein Ribosomal protein L11, C-terminal domain [46908] (2 species) 
Species Bacillus stearothermophilus [TaxId:1422] [46909] (6 PDB entries) 
Domain d1foy__: 1foy - [16245]
Details for d1foy__
PDB Entry: 1foy (more details)
PDB Description: the rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, minimized average structure
SCOP Domain Sequences for d1foy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1foy__ a.4.7.1 (-) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus}
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved
SCOP Domain Coordinates for d1foy__:
Click to download the PDB-style file with coordinates for d1foy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1foy__:
- d1foy__ appears in SCOP 1.57
- d1foy__ appears in the current release, SCOPe 2.08, called d1foya_
View in 3D