Lineage for d1zcka_ (1zck A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875137Protein Protein tyrosine phosphatase type IVa [102418] (3 species)
  7. 2875148Species Norway rat (Rattus norvegicus) [TaxId:10116] [188182] (1 PDB entry)
  8. 2875149Domain d1zcka_: 1zck A: [162442]
    automated match to d1rxda_
    complexed with acy

Details for d1zcka_

PDB Entry: 1zck (more details), 1.9 Å

PDB Description: native structure prl-1 (ptp4a1)
PDB Compounds: (A:) protein tyrosine phosphatase 4a1

SCOPe Domain Sequences for d1zcka_:

Sequence, based on SEQRES records: (download)

>d1zcka_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
avqfirqkrrgafnskqllylekyrpkmrlrf

Sequence, based on observed residues (ATOM records): (download)

>d1zcka_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyedav
qfirqkrrgafnskqllylekyrpkmrlrf

SCOPe Domain Coordinates for d1zcka_:

Click to download the PDB-style file with coordinates for d1zcka_.
(The format of our PDB-style files is described here.)

Timeline for d1zcka_: