SCOPe 2.01: Domain d1z9pb_: 1z9p B:

Lineage for d1z9pb_ (1z9p B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Haemophilus ducreyi [TaxId:730] [188174] (1 PDB entry)

8. Domain d1z9pb_: 1z9p B: [162424]
   automated match to d2apsa_
   complexed with cu, zn

Details for d1z9pb_

PDB Entry: 1z9p, 1.5 Å

PDB Description: X-Ray structure of a Cu-Zn superoxide dismutase from Haemophilus ducreyi

PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1z9pb_:

Sequence; same for both SEQRES and ATOM records:

>d1z9pb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Haemophilus ducreyi [TaxId: 730]}
ekivvpvqqldpqngnkdvgtveitesayglvftpklhdlahglhgfhihekpscepkek
dgklvaglgagghwdpkqtqkhgypwsddahmgdlpalfvmhdgsattpvlaprlkklae
vkghslmihaggdnhsdhpaplggggprmacgvik

Timeline for d1z9pb_:

• d1z9pb_ is new in SCOPe 2.01-stable
  
• d1z9pb_ appears in SCOPe 2.02
  
• d1z9pb_ appears in the current release, SCOPe 2.08