SCOPe 2.01: Domain d1z76b_: 1z76 B:

Lineage for d1z76b_ (1z76 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (7 PDB entries)

8. Domain d1z76b_: 1z76 B: [162395]
   automated match to d1u73a_
   complexed with pbp

Details for d1z76b_

PDB Entry: 1z76, 1.85 Å

PDB Description: crystal structure of an acidic phospholipase a2 (btha-i) from bothrops jararacussu venom complexed with p-bromophenacyl bromide

PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1z76b_:

Sequence; same for both SEQRES and ATOM records:

>d1z76b_ a.133.1.2 (B:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc

Timeline for d1z76b_:

• d1z76b_ is new in SCOPe 2.01-stable
  
• d1z76b_ appears in SCOPe 2.02
  
• d1z76b_ appears in the current release, SCOPe 2.08