Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.0: automated matches [191510] (1 protein) not a true family |
Protein automated matches [190849] (8 species) not a true protein |
Species Methanosarcina barkeri [TaxId:2208] [188169] (1 PDB entry) |
Domain d1z69d_: 1z69 D: [162393] automated match to d1f07a_ complexed with 1pg, cl, f42 |
PDB Entry: 1z69 (more details), 2.61 Å
SCOPe Domain Sequences for d1z69d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z69d_ c.1.16.0 (D:) automated matches {Methanosarcina barkeri [TaxId: 2208]} mkfgiefvpsdpalkiayyaklseqqgfdhvwitdhynnrdvystltvlalntnsikigp gvtnsytrnpaitassiasiaeisggravlglgpgdkatfdamgiawkkplattkeaiqa irdfisgkkvsmdgemikfagaklafkagnipiymgaqgpkmlelageiadgvlinashp kdfevaveqikkgaekagrdpsevdvtayacfsidkdpvkavnaakvvvafivagspdlv lerhgipveaksqigaaiakgdfgalmgglvtpqmieafsicgtpddcmkrikdleaigv tqivagspigpakekaikligkeiiak
Timeline for d1z69d_: