Lineage for d1z4ah_ (1z4a H:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084902Protein automated matches [190041] (21 species)
    not a true protein
  7. 1085143Species Thermotoga maritima [TaxId:243274] [188168] (1 PDB entry)
  8. 1085151Domain d1z4ah_: 1z4a H: [162384]
    automated match to d1vlga_
    complexed with lfa

Details for d1z4ah_

PDB Entry: 1z4a (more details), 2.3 Å

PDB Description: Ferritin from T. maritima
PDB Compounds: (H:) Ferritin

SCOPe Domain Sequences for d1z4ah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4ah_ a.25.1.1 (H:) automated matches {Thermotoga maritima [TaxId: 243274]}
mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOPe Domain Coordinates for d1z4ah_:

Click to download the PDB-style file with coordinates for d1z4ah_.
(The format of our PDB-style files is described here.)

Timeline for d1z4ah_: