Lineage for d1z3sa1 (1z3s A:281-495)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002936Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 3002937Protein automated matches [190726] (1 species)
    not a true protein
  7. 3002938Species Human (Homo sapiens) [TaxId:9606] [187887] (56 PDB entries)
  8. 3003030Domain d1z3sa1: 1z3s A:281-495 [162371]
    Other proteins in same PDB: d1z3sa2, d1z3sb2
    automated match to d1jc9a_
    complexed with ca

Details for d1z3sa1

PDB Entry: 1z3s (more details), 2.35 Å

PDB Description: Angiopoietin-2 Receptor Binding Domain
PDB Compounds: (A:) Angiopoietin-2

SCOPe Domain Sequences for d1z3sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3sa1 d.171.1.0 (A:281-495) automated matches {Human (Homo sapiens) [TaxId: 9606]}
frdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtwk
eykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelnyr
ihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmyy
pqrqntnkfngikwyywkgsgyslkattmmirpad

SCOPe Domain Coordinates for d1z3sa1:

Click to download the PDB-style file with coordinates for d1z3sa1.
(The format of our PDB-style files is described here.)

Timeline for d1z3sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z3sa2