Lineage for d1fc3a_ (1fc3 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308617Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2308697Family a.4.6.3: Spo0A [46903] (1 protein)
    elaborated with additional helices
    automatically mapped to Pfam PF08769
  6. 2308698Protein Spo0A [46904] (2 species)
  7. 2308699Species Bacillus stearothermophilus [TaxId:1422] [46905] (1 PDB entry)
  8. 2308700Domain d1fc3a_: 1fc3 A: [16237]
    CASP4

Details for d1fc3a_

PDB Entry: 1fc3 (more details), 2 Å

PDB Description: the crystal structure of trans-activation domain of the sporulation response regulator, spo0a
PDB Compounds: (A:) spo0a

SCOPe Domain Sequences for d1fc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc3a_ a.4.6.3 (A:) Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
nkpknldasitsiiheigvpahikgylylreaiamvyhdiellgsitkvlypdiakkynt
tasrverairhaievawsrgnlesisslfgytvsvskakptnsefiamvadklrlehka

SCOPe Domain Coordinates for d1fc3a_:

Click to download the PDB-style file with coordinates for d1fc3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fc3a_: