Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Heteractis crispa [TaxId:175771] [188161] (2 PDB entries) |
Domain d1yzwc_: 1yzw C: [162346] automated match to d1xqma_ complexed with peg |
PDB Entry: 1yzw (more details), 2.1 Å
SCOPe Domain Sequences for d1yzwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzwc_ d.22.1.1 (C:) automated matches {Heteractis crispa [TaxId: 175771]} gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhgt nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkavr altmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpek
Timeline for d1yzwc_: