Lineage for d1yxta_ (1yxt A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221311Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. 1221312Species Human (Homo sapiens) [TaxId:9606] [118134] (35 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. 1221318Domain d1yxta_: 1yxt A: [162327]
    automated match to d1xqza_
    complexed with anp

Details for d1yxta_

PDB Entry: 1yxt (more details), 2 Å

PDB Description: crystal structure of kinase pim1 in complex with amppnp
PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d1yxta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxta_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs

SCOPe Domain Coordinates for d1yxta_:

Click to download the PDB-style file with coordinates for d1yxta_.
(The format of our PDB-style files is described here.)

Timeline for d1yxta_: