SCOPe 2.02: Domain d1yuoa_: 1yuo A:

Lineage for d1yuoa_ (1yuo A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (14 PDB entries)

8. Domain d1yuoa_: 1yuo A: [162305]
   automated match to d1akza_

Details for d1yuoa_

PDB Entry: 1yuo, 1.95 Å

PDB Description: optimisation of the surface electrostatics as a strategy for cold adaptation of uracil-dna n-glycosylase (ung)from atlantic cod (gadus morhua)

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1yuoa_:

Sequence; same for both SEQRES and ATOM records:

>d1yuoa_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppslvniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d1yuoa_:

• d1yuoa_ first appeared in SCOPe 2.01
  
• d1yuoa_ appears in SCOPe 2.03
  
• d1yuoa_ appears in the current release, SCOPe 2.08