Lineage for d1yoka_ (1yok A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097817Protein automated matches [190059] (12 species)
    not a true protein
  7. 1097846Species Human (Homo sapiens) [TaxId:9606] [187214] (102 PDB entries)
  8. 1097996Domain d1yoka_: 1yok A: [162275]
    automated match to d1pk5a_
    complexed with p6l

Details for d1yoka_

PDB Entry: 1yok (more details), 2.5 Å

PDB Description: crystal structure of human LRH-1 bound with TIF-2 peptide and phosphatidylglycerol
PDB Compounds: (A:) Orphan nuclear receptor NR5A2

SCOPe Domain Sequences for d1yoka_:

Sequence, based on SEQRES records: (download)

>d1yoka_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsivew
arssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasq
agatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvna
alldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha

Sequence, based on observed residues (ATOM records): (download)

>d1yoka_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siphlilellkcepdepqvqakimaylqqeqanrsklstfglmckmadqtlfsivewars
siffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqaga
tlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaall
dytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha

SCOPe Domain Coordinates for d1yoka_:

Click to download the PDB-style file with coordinates for d1yoka_.
(The format of our PDB-style files is described here.)

Timeline for d1yoka_: