SCOPe 2.01: Domain d1yoka_: 1yok A:

Lineage for d1yoka_ (1yok A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)

8. Domain d1yoka_: 1yok A: [162275]
   automated match to d1pk5a_
   complexed with p6l

Details for d1yoka_

PDB Entry: 1yok, 2.5 Å

PDB Description: crystal structure of human LRH-1 bound with TIF-2 peptide and phosphatidylglycerol

PDB Compounds: (A:) Orphan nuclear receptor NR5A2

SCOPe Domain Sequences for d1yoka_:

Sequence, based on SEQRES records:

>d1yoka_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsivew
arssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasq
agatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvna
alldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha

Sequence, based on observed residues (ATOM records):

>d1yoka_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siphlilellkcepdepqvqakimaylqqeqanrsklstfglmckmadqtlfsivewars
siffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqaga
tlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaall
dytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha

Timeline for d1yoka_:

• d1yoka_ is new in SCOPe 2.01-stable
  
• d1yoka_ appears in SCOPe 2.02
  
• d1yoka_ appears in the current release, SCOPe 2.08