SCOPe 2.06: Domain d1yn8f1: 1yn8 F:2-59

Lineage for d1yn8f1 (1yn8 F:2-59)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries)

8. Domain d1yn8f1: 1yn8 F:2-59 [162265]
   Other proteins in same PDB: d1yn8a2, d1yn8b2, d1yn8c2, d1yn8d2, d1yn8e2, d1yn8f2
   automated match to d1uj0a_
   complexed with ca

Details for d1yn8f1

PDB Entry: 1yn8, 1.7 Å

PDB Description: sh3 domain of yeast nbp2

PDB Compounds: (F:) NAP1-binding protein 2

SCOPe Domain Sequences for d1yn8f1:

Sequence; same for both SEQRES and ATOM records:

>d1yn8f1 b.34.2.0 (F:2-59) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq

Timeline for d1yn8f1:

• d1yn8f1 first appeared in SCOPe 2.01, called d1yn8f_
  
• d1yn8f1 was called d1yn8f_ in SCOPe 2.05
  
• d1yn8f1 appears in SCOPe 2.07
  
• d1yn8f1 appears in the current release, SCOPe 2.08