Lineage for d1ymhf_ (1ymh F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541749Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2541750Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2541879Protein automated matches [190067] (6 species)
    not a true protein
  7. 2541894Species Finegoldia magna [TaxId:334413] [188140] (1 PDB entry)
  8. 2541896Domain d1ymhf_: 1ymh F: [162252]
    Other proteins in same PDB: d1ymha1, d1ymha2, d1ymhb1, d1ymhb2, d1ymhc1, d1ymhc2, d1ymhd1, d1ymhd2
    automated match to d1heze_
    mutant

Details for d1ymhf_

PDB Entry: 1ymh (more details), 2.6 Å

PDB Description: anti-HCV Fab 19D9D6 complexed with protein L (PpL) mutant A66W
PDB Compounds: (F:) protein l

SCOPe Domain Sequences for d1ymhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymhf_ d.15.7.1 (F:) automated matches {Finegoldia magna [TaxId: 334413]}
keevtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytwdledggnhmni
kfagk

SCOPe Domain Coordinates for d1ymhf_:

Click to download the PDB-style file with coordinates for d1ymhf_.
(The format of our PDB-style files is described here.)

Timeline for d1ymhf_: