SCOPe 2.02: Domain d1ymhe_: 1ymh E:

Lineage for d1ymhe_ (1ymh E:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein automated matches [190067] (3 species)
   not a true protein

7. Species Finegoldia magna [TaxId:334413] [188140] (1 PDB entry)

8. Domain d1ymhe_: 1ymh E: [162251]
   automated match to d1heze_
   mutant

Details for d1ymhe_

PDB Entry: 1ymh, 2.6 Å

PDB Description: anti-HCV Fab 19D9D6 complexed with protein L (PpL) mutant A66W

PDB Compounds: (E:) protein l

SCOPe Domain Sequences for d1ymhe_:

Sequence; same for both SEQRES and ATOM records:

>d1ymhe_ d.15.7.1 (E:) automated matches {Finegoldia magna [TaxId: 334413]}
keevtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytwdledggnhmni
kfagk

Timeline for d1ymhe_:

• d1ymhe_ first appeared in SCOPe 2.01
  
• d1ymhe_ appears in SCOPe 2.03
  
• d1ymhe_ appears in the current release, SCOPe 2.08