SCOPe 2.06: Domain d1ylzb_: 1ylz B:

Lineage for d1ylzb_ (1ylz B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (66 PDB entries)

8. Domain d1ylzb_: 1ylz B: [162247]
   automated match to d1iysa_
   complexed with cb4, po4

Details for d1ylzb_

PDB Entry: 1ylz, 1.35 Å

PDB Description: X-ray crystallographic structure of CTX-M-14 beta-lactamase complexed with ceftazidime-like boronic acid

PDB Compounds: (B:) beta-lactamase CTX-M-14

SCOPe Domain Sequences for d1ylzb_:

Sequence; same for both SEQRES and ATOM records:

>d1ylzb_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

Timeline for d1ylzb_:

• d1ylzb_ first appeared in SCOPe 2.01
  
• d1ylzb_ appears in SCOPe 2.05
  
• d1ylzb_ appears in SCOPe 2.07
  
• d1ylzb_ appears in the current release, SCOPe 2.08