Lineage for d1ylja_ (1ylj A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1690950Species Escherichia coli [TaxId:562] [187306] (41 PDB entries)
  8. 1690953Domain d1ylja_: 1ylj A: [162236]
    automated match to d1iysa_
    complexed with so4, suc

Details for d1ylja_

PDB Entry: 1ylj (more details), 0.98 Å

PDB Description: atomic resolution structure of ctx-m-9 beta-lactamase
PDB Compounds: (A:) Beta-lactamase CTX-M-9a

SCOPe Domain Sequences for d1ylja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylja_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d1ylja_:

Click to download the PDB-style file with coordinates for d1ylja_.
(The format of our PDB-style files is described here.)

Timeline for d1ylja_: